Antimicrobial and immune peptides
LL-37 research peptide
LL-37 is the only cathelicidin-family peptide identified in humans. It is a 37-residue, cationic, amphipathic peptide released by proteolytic cleavage of the precursor protein hCAP18, and it is named for its two N-terminal leucine residues.
For in-vitro laboratory research only. Not for human or veterinary use.
Specifications
- Compound
- LL-37
- Also known as
- Cathelicidin antimicrobial peptide; hCAP18 (134-170)
- Class
- Antimicrobial and immune peptides
- Length
- 37 amino acids
- Sequence
[LL-37, 37 aa] Molecular formula
- C205H340N60O53
- Molecular weight
- 4493 g/mol
- Form
- Lyophilized powder, sealed vial
- Vial sizes
- 5mg
- Purity release standard
- ≥ 99.0% by HPLC-UV, identity by LC-MS
- Storage
- −20 °C, dry, protected from light
- PubChem
- CID 16198951
Lot release testing
Each LL-37 lot is released only after it passes every assay below. Lots under 99.0% purity do not ship.
| Assay | Method | Release criterion |
|---|---|---|
| Purity | HPLC-UV | ≥ 99.0% |
| Net peptide content | Quantitative HPLC | ≥ 100% of label |
| Identity | LC-MS | Matches theoretical mass |
| Appearance | Visual | White lyophilized cake |
| Fentanyl screen | LC-MS/MS | Not detected |
| Heavy metals | ICP-MS | Within specification |
| Sterility | PCR | Not detected |
| Endotoxin | LAL | Within specification |
Frequently asked questions
What is LL-37?
LL-37 is the only cathelicidin-family peptide identified in humans. It is a 37-residue, cationic, amphipathic peptide released by proteolytic cleavage of the precursor protein hCAP18, and it is named for its two N-terminal leucine residues.
How is each LL-37 lot tested?
Every lot is tested at an ISO/IEC 17025 accredited third-party laboratory against an eight-assay panel: HPLC-UV purity, quantitative net peptide content, LC-MS identity, appearance, a fentanyl screen, heavy metals by ICP-MS, sterility by PCR, and endotoxin by LAL. The certificate is published before the lot ships.
How do I verify the certificate for my LL-37 vial?
Scan the QR code on the vial label to open the certificate for that exact lot, or search the lot number in the North Wall COA library.
Is LL-37 for human use?
No. North Wall sells this compound solely for in-vitro laboratory research by qualified researchers aged 21 and over. It is not for human or veterinary use, and North Wall does not provide use, preparation, or dosing guidance.
Related reference pages
Molecular data: PubChem CID 16198951. Lot-specific values appear on the certificate for each batch.